Antimicrobial Peptide AP03085

     
 

APD ID:

AP03085

 
 

Name/Class:

hRETN (human resistin, mammals, animals; UCSS)

 
 

Source:

skin, Homo sapiens

 
 

Sequence:

SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

 
 

Length:

92

 
 

Net charge:

0

 
 

Hydrophobic residue%:

43%

 
 

Boman Index:

1.59 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence of the peptide shows 27.5% similarity to Carnolysin. Vatamin A deficiency increases the risk of skin infection. Why? Hooper and colleagues found that vitamin A can induce the expression of human resistin, which has antimicrobial effect. This deepens our understanding of the role of vitamins in skin innate immunity. Read the commentary here of this work. 7/2019

 
       
 

Title:

Resistin-like Molecule alpha Provides Vitamin-A-Dependent Antimicrobial Protection in the Skin

 
 

Author:

Harris TA, Gattu S, Propheter DC, Kuang Z, Bel S, Ruhn KA, Chara AL, Edwards M, Zhang C, Jo JH, Raj P, Zouboulis CC, Kong HH, Segre JA, Hooper LV.2019

 
 

Reference:

Cell Host Microbe. 2019 Jun 12;25(6):777-788.e8. doi: 10.1016/j.chom.2019.04.004 PubMed

 
       

Close this window