Antimicrobial Peptide AP02927

     
 

APD ID:

AP02927

 
 

Name/Class:

Beta-defensin 130 (DEFB130, human, mammals; 3S=S; UCSS1a)

 
 

Source:

macrophage; Homo sapiens

 
 

Sequence:

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

 
 

Length:

57

 
 

Net charge:

5

 
 

Hydrophobic residue%:

36%

 
 

Boman Index:

1.39 kcal/mol

 
 

3D Structure:

Bridge

 
 

Method:

CD

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence of this peptide shows 33.8% similarity to hBD-3. Molecular formula: C277H457N77O77S6; Mol Wt 6301.509. GRAVY= -0.36; Wimley-White whole-residue hydrophobicity of the peptide: 12.62 kcal/mol. CD spectrum with a negative band at 205 nm supports beta-structure. Active against P. falciparum (IC50 43-49 uM). Knockdown of DEFB130 expression in macrophages resulted in a reduced antiplasmodial activity in vitro. Animal model:mouse: Treating the mice with DEFB130 synthetic peptide resulted in a temporal decrease in parasitemia P. yoelii in vivo,, which can be explained by the number of drug administration. Thus, DEFB130 might be one of the macrophage effector molecules for eliminating malarial parasites.

 
       
 

Title:

Involvement of ?-defensin 130 (DEFB130) in the macrophage microbicidal mechanisms for killing Plasmodium falciparum.

 
 

Author:

Terkawi MA, Takano R, Furukawa A, Murakoshi F, Kato K.2017

 
 

Reference:

Sci Rep. 2017 Feb 9;7:41772. doi: 10.1038/srep41772.PubMed

 
       

Close this window