Antimicrobial Peptide AP02756

     
 

APD ID:

AP02756

 
 

Name/Class:

STiDA-1 (Defensins Ancestor; UCSS1a; 3S=S)

 
 

Source:

Deduced; synthetic

 
 

Sequence:

GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKTRPPFILG

 
 

Length:

55

 
 

Net charge:

7

 
 

Hydrophobic residue%:

27%

 
 

Boman Index:

1.71 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

This Scorpions-Ticks Defensins Ancestor (STiDA) shows 69.8% similarity to Scapularisin-6. The entire sequences of the two STiDA peptides differ slightly.

 
       
 

Title:

Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.

 
 

Author:

Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Valdés JJ. 2016

 
 

Reference:

Front Microbiol. 2016 Oct 24;7:1682. PubMed

 
       

Close this window