Antimicrobial Peptide AP02755

     
 

APD ID:

AP02755

 
 

Name/Class:

DefMT7 (defensin MT7; UCSS1a; 3S=S, hard ticks, arachnids, Chelicerata, arthropods, invertebrates, animals)

 
 

Source:

Ixodes ricinus

 
 

Sequence:

GFGCPKSALSCSQQCRENNTHSGGYCNGPFNIVCSCY

 
 

Length:

37

 
 

Net charge:

1

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

1.49 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence of THE PEPTIDE shows 48.8% similarity to Insect defensin. Initially reported by (Tonk M et al., 2015). The peptide showed no activity against bacteria. This study found antimalarial activity, establishing it as an AMP.

 
       
 

Title:

Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.

 
 

Author:

Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Valdés JJ. 2016

 
 

Reference:

Front Microbiol. 2016 Oct 24;7:1682. PubMed

 
       

Close this window