Antimicrobial Peptide AP02591

     
 

APD ID:

AP02591

 
 

Name/Class:

DefMT6 (defensin MT6; UCSS1a; 3S=S, hard ticks, arachnids, Chelicerata, arthropods, invertebrates, animals; inactive peptides: DefMT2, DefMT7)

 
 

Source:

salivary glands, ovaries and Malpighian tubules, Ixodes ricinus

 
 

Sequence:

GFGCPLNQGACHNHCRSIKRRGGYCSGIIKQTCTCYRK

 
 

Length:

38

 
 

Net charge:

7

 
 

Hydrophobic residue%:

31%

 
 

Boman Index:

2.22 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, antifungal, antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence of this peptide most resembles (94.7% similarity) Longicin. Mol Wt: 4211.9; Mol Extinction coeff 3355; mol formula: C175H285N59O49S6. Active against L. monocytogenes (MIC 0.05 uM), L. fleischmannii (MIC 1 uM), L. grayi (MIC 2 uM) and L. seeligeri (MIC 0.5 uM), S. aureus (MIC 2 uM), and Gram- P. aeruginosa (MIC 2 uM). It is most potent in this series of defensins. Bacteriostatic effects on S. epidermidis and E. coli. In addition, it completely inhibited the germination of fungi F. culmorum (IC50 12 uM) and F. graminearum (IC50 2 uM).

 
       
 

Title:

Ixodes ricinus defensins attack distantly-related pathogens.

 
 

Author:

Tonk M, Cabezas-Cruz A, Valdés JJ, Rego RO, Grubhoffer L, Estrada-Peña A, Vilcinskas A, Kotsyfakis M, Rahnamaeian M.2015

 
 

Reference:

Dev Comp Immunol. 2015 Dec;53(2):358-65.PubMed

 
       

Close this window