Antimicrobial Peptide AP02590

     
 

APD ID:

AP02590

 
 

Name/Class:

DefMT5 (defensin MT5; UCSS1a; 3S=S, hard ticks, arachnids, Chelicerata, arthropods, invertebrates, animals)

 
 

Source:

salivary glands, Ixodes ricinus

 
 

Sequence:

GFFCPYNGYCDRCRKKLRRRGGYCGGRWKLTCICIMN

 
 

Length:

37

 
 

Net charge:

8

 
 

Hydrophobic residue%:

37%

 
 

Boman Index:

2.36 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, antifungal, antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence of this peptide most resembles (59.0% similarity) scorpion defensin. Mol Wt: 4390.29; Mol Extinction coeff 10395; mol formula: C190H300N59O46S7. Active against L. monocytogenes (MIC 1 uM), L. fleischmannii (MIC 15 uM), L. grayi (MIC 8 uM) and L. seeligeri (MIC 15 uM), S. aureus (MIC 15 uM), and Gram- P. aeruginosa (MIC 15 uM). In addition, it completely inhibited the germination of fungi F. culmorum (IC50 4 uM) and F. graminearum (IC50 4 uM).

 
       
 

Title:

Ixodes ricinus defensins attack distantly-related pathogens.

 
 

Author:

Tonk M, Cabezas-Cruz A, Valdés JJ, Rego RO, Grubhoffer L, Estrada-Peña A, Vilcinskas A, Kotsyfakis M, Rahnamaeian M.2015

 
 

Reference:

Dev Comp Immunol. 2015 Dec;53(2):358-65. PubMed

 
       

Close this window