Antimicrobial Peptide AP02589

     
 

APD ID:

AP02589

 
 

Name/Class:

DefMT3 (defensin MT3; UCSS1a; 3S=S, hard ticks, arachnids, Chelicerata, arthropods, invertebrates, animals; Variant: DefMT4)

 
 

Source:

Ixodes ricinus

 
 

Sequence:

GYYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK

 
 

Length:

38

 
 

Net charge:

9

 
 

Hydrophobic residue%:

34%

 
 

Boman Index:

2.7 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, antifungal, antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence of this peptide most resembles (87.2% similarity) Ir-Def2 from the same species. Mol Wt: 4525.38; Mol Extinction coeff 4845; mol formula: C197H307N63O48S6. Active against L. monocytogenes (MIC 15 uM), L. fleischmannii (MIC 60 uM), L. grayi (MIC 8 uM) and L. seeligeri (MIC 15 uM), S. aureus (MIC 60 uM), and Gram- P. aeruginosa (MIC 30 uM). In addition, it completely inhibited the germination of fungi F. culmorum (IC50 4 uM) and F. graminearum (IC50 4 uM). Note that DefMT3 and DefMT4 are isoforms that share 98% identity at the nucleotide and protein levels and they have identical mature peptide sequences, suggesting they have the same activity.

 
       
 

Title:

Ixodes ricinus defensins attack distantly-related pathogens.

 
 

Author:

Tonk M, Cabezas-Cruz A, Valdés JJ, Rego RO, Grubhoffer L, Estrada-Peña A, Vilcinskas A, Kotsyfakis M, Rahnamaeian M.2015

 
 

Reference:

Dev Comp Immunol. 2015 Dec;53(2):358-65. PubMed

 
       

Close this window