Antimicrobial Peptide AP02561

     
 

APD ID:

AP02561

 
 

Name/Class:

MeuTXKbeta1 (scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals; 3S=S, UCSS1a)

 
 

Source:

venom, Mesobuthus eupeus

 
 

Sequence:

GFREKHFQRFVKYAVPESTLRTVLQTVVHKVGKTQFGCPAYQGYCDDHCQDIEKKEGFCHGFKCKCGIPMGF

 
 

Length:

72

 
 

Net charge:

4

 
 

Hydrophobic residue%:

36%

 
 

Boman Index:

1.62 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, antiparasitic, Antimalarial, Mammalian cells,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence is 40.2% similar to scorpion Scorpine. Active against rodent malaria P. berghei (10-20 uM inbiting 89-99%), lower than scorpine but higher than shiva-3 and gambicin. In this concentration range, it is slightly hemolytic to mouse blood cells 10-15%). The N-terminus, when studied alone by NMR, can be helical in TFE. The C-terminus is predicted to have a CS-alphabeta motif.

 
       
 

Title:

MeuTXKbeta1, a scorpion venom-derived two-domain potassium channel toxin-like peptide with cytolytic activity

 
 

Author:

Zhu S, Gao B, Aumelas A, del Carmen Rodríguez M, Lanz-Mendoza H, Peigneur S, Diego-Garcia E, Martin-Eauclaire MF, Tytgat J, Possani LD.2010

 
 

Reference:

Biochim Biophys Acta. 2010 Apr;1804(4):872-83. PubMed

 
       

Close this window