Antimicrobial Peptide AP02553

     
 

APD ID:

AP02553

 
 

Name/Class:

Psalmopeotoxin I (PcFK1; U1-TRTX-Pc1a; spiders, arachnids, Chelicerata, arthropods, invertebrates, animals; XXA, 3S=S, UCSS1a )

 
 

Source:

venom, the Trinnidad chevron tarantula, Psalmopoeus cambridgei

 
 

Sequence:

ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV

 
 

Length:

33

 
 

Net charge:

3

 
 

Hydrophobic residue%:

48%

 
 

Boman Index:

0.87 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1X5V   Go to PDB

 
 

Activity:

antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

APD analysis reveals that the sequence is 39.1% similar to Tachystatin A. It inhibited P. falciparum at 1.59 uM. You can rotate, zoom, and view the 3D structure here in the PDB. Provided by Xiuqing Wang.

 
       
 

Title:

Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei.

 
 

Author:

Choi SJ, Parent R, Guillaume C, Deregnaucourt C, Delarbre C, Ojcius DM, Montagne JJ, CÚlÚrier ML, Phelipot A, Amiche M, Molgo J, Camadro JM, Guette C.2004

 
 

Reference:

FEBS Lett. 2004 Aug 13;572(1-3):109-17. PubMed

 
       

Close this window