Antimicrobial Peptide AP02205

     
 

APD ID:

AP02205

 
 

Name/Class:

Gambicin (insects, arthropods, invertebrates, animals; 4S=S)

 
 

Source:

midgut, fatbody, and hemocyte-like cell; mosquito, Anopheles gambiae

 
 

Sequence:

MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFL

 
 

Length:

61

 
 

Net charge:

4

 
 

Hydrophobic residue%:

39%

 
 

Boman Index:

1.78 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, antiparasitic, Antimalarial,

 
 

Crucial residues:

Disulfide bonds

 
 

Additional info:

The oxidized form was active against E. coli (MIC 6.25-12.5 uM) and M. luteus (MIC 25-50 uM). It also has an effect on filamentus fungus and rodent malaria parasite P. berghei. The reduced form is less active. Updated 5/13/2014.

 
       
 

Title:

Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae

 
 

Author:

Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Müller HM, Dimopoulos G.2001

 
 

Reference:

Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5.Pub-Med.

 
       

Close this window