Antimicrobial Peptide AP02182

     
 

APD ID:

AP02182

 
 

Name/Class:

DEFB114 (human beta defensin 114, UCSS1a; 4S=S, primates, mammals, animals; BBL)

 
 

Source:

epididymis and gingival cells , Homo sapiens

 
 

Sequence:

DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF

 
 

Length:

43

 
 

Net charge:

0

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

3.58 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal,

 
 

Crucial residues:

 
 

Additional info:

Active against E. coli, S. aureus, and C. albicans. Activity is salt-sensitive. In addition, this human beta defensin protects sperm from motility loss.

 
       
 

Title:

The novel human beta-defensin 114 regulates lipopolysaccharide(LPS)-mediated inflammation and protects sperm from motility loss

 
 

Author:

Yu H, Dong J, Gu Y, Liu H, Xin A, Shi H, Sun F, Zhang Y, Lin D, Diao H.2013

 
 

Reference:

J Biol Chem. 2013 Apr 26;288(17):12270-82. Pub-Med.

 
       

Close this window