Antimicrobial Peptide AP02158

     
 

APD ID:

AP02158

 
 

Name/Class:

hPF4 (human Platelet Factor 4 or CXCL4, chemokine, CXC family; kinocidins; primates, mammals, animals; ZZP: Derivatives: RP-1)

 
 

Source:

Homo sapiens

 
 

Sequence:

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

 
 

Length:

70

 
 

Net charge:

3

 
 

Hydrophobic residue%:

40%

 
 

Boman Index:

1.46 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

Human PF4 kills malaria parasites P. falciparum inside erythrocytes by selectively lysing the parasite digestive vacuole (DV). hPF4 comprised three domains: an N-terminal chemokine domain, a central domain responsible for homotetramerization, and a C-terminal amphipathic helical region with HDP activity (Yeaman et al., 2007). The C-terminal domain is responsible for antimicrobial activity. RP-1 was designed based on the C-terminal HDP domain (Yeaman MR, et al 2002).

 
       
 

Title:

Platelet Factor 4 Activity against P. falciparum and Its Translation to Nonpeptidic Mimics as Antimalarials.

 
 

Author:

Love MS, Millholland MG, Mishra S, Kulkarni S, Freeman KB, Pan W, Kavash RW, Costanzo MJ, Jo H, Daly TM, Williams DR, Kowalska MA, Bergman LW, Poncz M, Degrado WF, Sinnis P, Scott RW, Greenbaum DC.2012

 
 

Reference:

Cell Host Microbe. 2012 Dec 13;12(6):815-23. Pub-Med.

 
       

Close this window