Antimicrobial Peptide AP02095

     
 

APD ID:

AP02095

 
 

Name/Class:

SLPI (secretory leukocyte protease inhibitor, antileukoprotease, ALP, UCSS1a; human, primates, mammals, animals; 8S=S; BBMm; BBN)

 
 

Source:

tears, saliva, airway, gastrointestines, genital tracts, Homo sapiens

 
 

Sequence:

SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

 
 

Length:

107

 
 

Net charge:

12

 
 

Hydrophobic residue%:

34%

 
 

Boman Index:

1.87 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

X-ray

 
 

SwissProt ID:

PDB ID: 2Z7F   Go to PDB

 
 

Activity:

anti-Gram+ & Gram-, antiviral, antifungal, anti-HIV, Enzyme inhibitor,

 
 

Crucial residues:

 
 

Additional info:

Active against metabolically active fungi A. fumigatus and C. albicans but not metabolically quiescent forms. Antifungal activity is localized to the N-terminal region (Tomee JF et al., 1997)). Crystal structure of SLPI was solved [Grütter, Fendrich, Huber & Bode (1988), EMBO J. 7, 345-351] as two whey acidic protein (WAP) domains, each containing 8 Cys. While the N-terminal domain is responsible for membrane lysis, the C-terminal domain is designed for inhibition. You can rotate, zoom, and view the 3D structure here in the PDB . Updated 11/2014.

 
       
 

Title:

Secretory leukocyte protease inhibitor binding to mRNA and DNA as a possible cause of toxicity to Escherichia coli

 
 

Author:

Miller KW, Evans RJ, Eisenberg SP, Thompson RC.1989

 
 

Reference:

J Bacteriol. 1989 Apr;171(4):2166-72. Pub-Med. GenBank:CAA28187.1

 
       

Close this window