| |
APD ID: |
AP02095 |
|
| |
Name/Class: |
SLPI (secretory leukocyte protease inhibitor, antileukoprotease, ALP, UCSS1a; human, primates, mammals, animals; 8S=S; BBMm; BBN) |
|
| |
Source: |
tears, saliva, airway, gastrointestines, genital tracts, Homo sapiens |
|
| |
Sequence: |
SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA |
|
| |
Length: |
107 |
|
| |
Net charge: |
12 |
|
| |
Hydrophobic residue%: |
34% |
|
| |
Boman Index: |
1.87 kcal/mol |
|
| |
3D Structure: |
Beta |
|
| |
Method: |
X-ray |
|
| |
SwissProt ID: |
PDB ID:
2Z7F
Go to PDB
|
|
| |
Activity: |
anti-Gram+ & Gram-, antiviral, antifungal, anti-HIV, Enzyme inhibitor, |
|
| |
Crucial residues: |
|
|
| |
Additional info: |
Active against metabolically active fungi A. fumigatus and C. albicans but not metabolically quiescent forms. Antifungal activity is localized to the N-terminal region (Tomee JF et al., 1997)). Crystal structure of SLPI was solved [Grütter, Fendrich, Huber & Bode (1988), EMBO J. 7, 345-351] as two whey acidic protein (WAP) domains, each containing 8 Cys. While the N-terminal domain is responsible for membrane lysis, the C-terminal domain is designed for inhibition. You can rotate, zoom, and view the 3D structure here in the PDB . Updated 11/2014. |
|
| |
|
|
|
| |
Title: |
Secretory leukocyte protease inhibitor binding to mRNA and DNA as a possible cause of toxicity to Escherichia coli |
|
| |
Author: |
Miller KW, Evans RJ, Eisenberg SP, Thompson RC.1989 |
|
| |
Reference: |
J Bacteriol. 1989 Apr;171(4):2166-72. Pub-Med. GenBank:CAA28187.1 |
|
| |
|
|
|
Close this window
|