Antimicrobial Peptide AP02073

     
 

APD ID:

AP02073

 
 

Name/Class:

RNase 7 (Ribonuclease 7; UCSS1a; 3S=S, human; primates, mammals, animals; BBomp)

 
 

Source:

keratinocytes, Skin, urinary tract, Homo sapiens

 
 

Sequence:

KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

 
 

Length:

128

 
 

Net charge:

16

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

2.16 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 2HKY   Go to PDB

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal,

 
 

Crucial residues:

A flexible lysine cluster (K1, K3, K111, and K112) is essential for activity (Huang et al., 2007).

 
 

Additional info:

Has ribonuclease activity. Active against bacteria such as M. vaccae and yeast even at 4 oC. Membrane permeable.

It is also found in human urinary tract (Spencer JD et al., 2011) and contributes to microbial defense. Recombinant RNase 7 exhibited antimicrobial activity against uropathogens (E. coli, P. aeruginosa, K. pneumonia, P. mirabilis, E. faecalis, and S. saprophyticus) at low micromolar concentrations by disrupting the microbial membrane as determined by atomic force microscopy (Spencer JD et al., 2013). It is concluded that RNase 7 is the most abundant AMP in the human urinary tract (Zasloff M, 2013). Michael Zasloff further commented that "In my opinion, the studies of Spencer et al. have rewritten our current understanding of the antibacterial defenses of the human urinary tract". RNase 7 is induced (highest after 6 h post infection) in response to airway epithelial cells infection of M. tuberculosis (Mtb) (anti-TB), implying a role in anti-mycobacterial immunity (Torres-Juarez F et al., 2018). You can rotate, zoom, and view the 3D structure here in the PDB .

Immune modualtion. RNase 7 enables human pDCs to recognize self-DNA and promotes their rapid sensing of bacterial DNA. RNase 7 was a markedly stronger trigger for IFN-? expression in human pDCs than the other antimicrobial peptides (Kopfnagel et al., 2018). Updated 1/17/2013; 2/2014; Jan2018; 10/2018 GW.

 
       
 

Title:

RNase 7, a novel innate immune defense antimicrobial protein of healthy human skin.

 
 

Author:

Harder J, Schroder JM.2002

 
 

Reference:

J Biol Chem. 2002 Nov 29;277(48):46779-84. Pub-Med. GenBank:NP_115961.2.

 
       

Close this window