Antimicrobial Peptide AP02040

     
 

APD ID:

AP02040

 
 

Name/Class:

Alpha-purothionin (alpha1-PTH; UCSS1a; plants; 4S=S)

 
 

Source:

wheat, Triticum aestivum

 
 

Sequence:

KSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPK

 
 

Length:

45

 
 

Net charge:

10

 
 

Hydrophobic residue%:

40%

 
 

Boman Index:

1.97 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

Method:

X-ray

 
 

SwissProt ID:

PDB ID: 2PLH   Go to PDB

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

Antimicrobial activity was observed as early as 1895 and the protein components crystallized in 1941. However, these effects are due to a mixture of purothionins till 1972. In this 1974 study, antibacterial activity of both mixture and separated alpha and beta-thionins were evaluated. In particular, the peptide showed activity against pathogens of plant origin. Amino acid sequence was reported in 1977 (J Biochem). Refined crystal structure was reported in 1995 (see the PDB link). You can rotate, zoom, and view the tetrameric crystal structure here in the PDB. Updated 2/2014; Ref updated 3/2015.

 
       
 

Title:

Inhibition of brewer's yeasts by wheat purothionins.

 
 

Author:

Hernandez-Lucas C, Fernandez de Caleya R, Carbonero P.1974

 
 

Reference:

Appl Microbiol. 1974 Aug;28(2):165-8. Pub-Med.

 
       

Close this window