Antimicrobial Peptide AP01971

     
 

APD ID:

AP01971

 
 

Name/Class:

Geobacillin I (lantibiotics, class 1 bacteriocin; Gram-positive bacteria, prokaryotes; XXT7; UCSS1b; XXW2)

 
 

Source:

Geobacillus thermodenitrificans NG80-2

 
 

Sequence:

VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC

 
 

Length:

33

 
 

Net charge:

2

 
 

Hydrophobic residue%:

48%

 
 

Boman Index:

0.5 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+,

 
 

Crucial residues:

Thioether rings

 
 

Additional info:

Although quite a few lantibiotics have been discovered, only one was found from thermophilic organism. Lantibiotics from thermophiles may have improved properties. This peptide was detected in five Geobacillus strains. Geobacillin I contains seven thioether cross-links, the highest degree of links in known lantibiotics. The thioether rings are as follows: S3-C7, T8-C11, T13-C18, T20-C24, S23-C27, S26-C30, and S29-C33 (determined by NMR). In addition, residues T2 and S5 are dehydrated into Dhb and Dha. This peptide appears to share rings 1 and 2 with nisin, but is more stable than nisin. Therefore, this peptide may be developed as a better version of nisin widely used in food preservation.

 
       
 

Title:

Lantibiotics from Geobacillus thermodenitrificans.

 
 

Author:

Garg N, Tang W, Goto Y, Nair SK, van der Donk WA.2012

 
 

Reference:

Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):5241-6. PubMed.

 
       

Close this window