Antimicrobial Peptide AP01716“>017162789.73 %95.16 %AVP
     
 

APD ID:

AP01716

 
 

Name/Class:

Esculentin-2PRa (frog, amphibians, animals; XXU; 1S=S, UCSS1a)

 
 

Source:

North America, the Oregon spotted frog Rana pretiosa

 
 

Sequence:

GVFSFLKTGAKLLGSTLLKMAGKAGAEHLACKATNQC

 
 

Length:

37

 
 

Net charge:

4

 
 

Hydrophobic residue%:

48%

 
 

Boman Index:

0.15 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

Antibacterial activity assays for the APD entries 1716 to 1727 were conducted using Gram-negative bacterium E. coli, Gram-positive S. aureus, and fungus C. albicans.

 
       
 

Title:

Host defense peptides in skin secretions of the Oregon spotted frog Ranapretiosa: implications for species resistance to chytridiomycosis

 
 

Author:

Conlon JM, Mechkarska M, Emanahmed, Coquet L, Jouenne T, Jérômeleprince, Vaudry H, Hayes MP, Padgett-Flohr G2011

 
 

Reference:

Dev Comp Immunol. 2011 Jun;35(6):644-9.

 
       

Close this window