Antimicrobial Peptide AP01580

     
 

APD ID:

AP01580

 
 

Name/Class:

Elafin (Elastase-specific inhibitor, UCSS1a; 3S=S, humans; primates, mammals, animals; Precursor: serine antiprotease trappin-2)

 
 

Source:

skin, Homo sapiens

 
 

Sequence:

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

 
 

Length:

57

 
 

Net charge:

3

 
 

Hydrophobic residue%:

42%

 
 

Boman Index:

0.94 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 2REL   Go to PDB

 
 

Activity:

anti-Gram+ & Gram-, antiviral, antifungal, antiparasitic, anti-HIV, Enzyme inhibitor, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

Active against HIV-1 and HSV-2 (Drannik AG, et al 2013). The anti-HIV activity of Elafin is 130 times more potent than its precursor serine antiprotease trappin-2 (Drannik AG, et al 2012). It is also antiparasitic and malaria (Roussilhon et al., 2017). You can rotate, zoom, and view the 3D structure here in the PDB. Updated 11/2014; 2/2017 GW.

 
       
 

Title:

Human gammadelta T cells produce the protease inhibitor and antimicrobial peptide elafin

 
 

Author:

Marischen L, Wesch D, Schröder JM, Wiedow O, Kabelitz D2009

 
 

Reference:

Scand J Immunol. 2009 Dec;70(6):547-52

 
       

Close this window