Antimicrobial Peptide AP01553

     
 

APD ID:

AP01553

 
 

Name/Class:

PsDef1 (P. sylvestris defensin 1, UCSS1a; 4S=S, plants)

 
 

Source:

Seeds, Scots pine, Pinus sylvestris

 
 

Sequence:

RMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP

 
 

Length:

50

 
 

Net charge:

7

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

2.04 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 5NCE   Go to PDB

 
 

Activity:

anti-Gram+ & Gram-, antifungal, Enzyme inhibitor,

 
 

Crucial residues:

 
 

Additional info:

Predicted 4 disulfide bonds arebetween residues 36-82, 47-67, 53-76, and 57-78. Active against fungi (B. cinerea IC50=0.4 ug/ml; F. oxysporum, 2.9; F. solani, 0.9; H. annosum 1.4 ug/ml), moderate activity against C. albicans and T. reesei. Activity against bacteria Gram+ B. pumilus (IC50 16.2 uM), Gram- P. carotovorum (IC50 10.8 uM), and P. carotovorum (IC50 20.4 uM). The peptide also inhibits alpha-amylases from human saliva. Updated 12/2014; 12/2017 GW.

 
       
 

Title:

Purification and molecular cloning of antimicrobial peptides from Scots pine seedlings.

 
 

Author:

Kovaleva V, Kiyamova R, Cramer R, Krynytskyy H, Gout I, Filonenko V, Gout R.2009

 
 

Reference:

Peptides. 2009 Dec;30(12):2136-43

 
       

Close this window