Antimicrobial Peptide AP01522“>015222149.48 %92.10 %AVP
     
 

APD ID:

AP01522

 
 

Name/Class:

Ap (A. purpuratus (AMP), scallop, marine bivalve mollusca/molluscs/mollusks, invertebrates, animals; BWQ; Derivative: Ap-S)

 
 

Source:

Argopecten purpuratus

 
 

Sequence:

TYMPVEEGEYIVNISYADQPKKNSPFTAKKQPGPKVDLSGVKAYGPG

 
 

Length:

47

 
 

Net charge:

1

 
 

Hydrophobic residue%:

25%

 
 

Boman Index:

1.38 kcal/mol

 
 

3D Structure:

Unknown

 
 

Method:

CD

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+, Antifungal,

 
 

Crucial residues:

 
 

Additional info:

It corresponds to the N-terminal 47 residues of the antimicrobial peptide. The designed peptide contains 30 residues. CD suggests a polyproline structure.

 
       
 

Title:

A novel antifungal peptide designed from the primary structure of a natural antimicrobial peptide purified from Argopecten purpuratus hemocytes

 
 

Author:

Arenas G, Guzmán F, Cárdenas C, Mercado L, Marshall SH.2009

 
 

Reference:

Peptides. 2009 Aug;30(8):1405-11.

 
       

Close this window