Antimicrobial Peptide AP01470

     
 

APD ID:

AP01470

 
 

Name/Class:

WAMP-1b (hevein-like peptide, UCSS1a; plants;chitin-binding, BBS; 5S=S)

 
 

Source:

wheat, Triticum kiharae

 
 

Sequence:

AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR

 
 

Length:

45

 
 

Net charge:

4

 
 

Hydrophobic residue%:

37%

 
 

Boman Index:

1.98 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, antifungal, Enzyme inhibitor,

 
 

Crucial residues:

 
 

Additional info:

Compared to WAMP-1a, WAMP-1b contains one additional Arg at the C-terminus. 10-Cys. MOA: This proteinase of fungi (fungalysin Fv-cmp) cleaves class IV chitinases, plant defense proteins that bind and degrade chitin of fungal cell walls. However, equal molar ratio of plant defensin WAMP-1b or WAMP-2 to chitinase was sufficient to block the fungalysin activity of fungi keeping the plant chitinase intact. Thus, WAMPs represent a novel type of protease inhibitors (enzyme inhibitor) being active against fungal metalloproteases (Slavokhotova etal., 2014). UPdated 8/2014.

 
       
 

Title:

A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif.

 
 

Author:

Odintsova TI, Vassilevski AA, Slavokhotova AA, Musolyamov AK, Finkina EI, Khadeeva NV, Rogozhin EA, Korostyleva TV, Pukhalsky VA, Grishin EV, Egorov TA.2009

 
 

Reference:

FEBS J. 2009 Aug;276(15):4266-75.

 
       

Close this window