Antimicrobial Peptide AP01464

     
 

APD ID:

AP01464

 
 

Name/Class:

AdDLP (A. dehalogenans defensin-like peptide, bacteriocin; Gram-negative bacteria, prokaryotes, ZZP)

 
 

Source:

Anaeromyxobacter dehalogenans

 
 

Sequence:

VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR

 
 

Length:

51

 
 

Net charge:

-1

 
 

Hydrophobic residue%:

37%

 
 

Boman Index:

1.72 kcal/mol

 
 

3D Structure:

Unknown

 
 

Method:

CD

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

antiparasitic, Antimalarial,

 
 

Crucial residues:

 
 

Additional info:

Active against P. falciparum ookinetes. Structure is predicted as an helix-beta fold based on homolog modeling and CD.

 
       
 

Title:

AdDLP, a bacterial defensin-like peptide, exhibits anti-Plasmodium activity.

 
 

Author:

Gao B, Rodriguez MD, Lanz-Mendoza H, Zhu S.2009

 
 

Reference:

Biochem Biophys Res Commun. 2009 Jul 15.

 
       

Close this window