Antimicrobial Peptide AP01254“>012541757.22 %90.55 %AVP
     
 

APD ID:

AP01254

 
 

Name/Class:

Brevinin-2PRb (Brevinin 2PRb, frog, amphibians, animals; XXU; 1S=S, UCSS1a)

 
 

Source:

the Hokkaido frog, Rana pirica, Asia

 
 

Sequence:

GLMSLFRGVLKTAGKHIFKNVGGSLLDQAKCKITGEC

 
 

Length:

37

 
 

Net charge:

4

 
 

Hydrophobic residue%:

43%

 
 

Boman Index:

0.65 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-, Hemolytic,

 
 

Crucial residues:

 
 

Additional info:

To be updated.

 
       
 

Title:

A family of brevinin-2 peptides with potent activity against Pseudomonas aeruginosa from the skin of the Hokkaido frog, Rana pirica.

 
 

Author:

Conlon JM, Sonnevend A, Patel M, Al-Dhaheri K, Nielsen PF, Kolodziejek J, Nowotny N, Iwamuro S, Pl T.2004

 
 

Reference:

Regul Pept. 2004 May 15;118(3):135-41. Pub-Med.

 
       

Close this window