Antimicrobial Peptide AP01186

     
 

APD ID:

AP01186

 
 

Name/Class:

Acidocin A (class 2 bacteriocins; Gram-positive bacteria, prokaryotes)

 
 

Source:

Lactobacillus acidophilus TK9201

 
 

Sequence:

KTYYGTNGVHCTKKSLWGKVRLKNVIPGTLCRKQSLPIKQDLKILLGWATGAFGKTFH

 
 

Length:

58

 
 

Net charge:

10

 
 

Hydrophobic residue%:

36%

 
 

Boman Index:

1.03 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+,

 
 

Crucial residues:

 
 

Additional info:

Active against L. monocytogenes. Updated 5/2019.

 
       
 

Title:

Isolation and characterization of acidocin A and cloning of the bacteriocin gene from Lactobacillus acidophilus.

 
 

Author:

Kanatani K, Oshimura M, Sano K.1995

 
 

Reference:

Appl Environ Microbiol. 1995 Mar;61(3):1061-7. PubMed

 
       

Close this window