Antimicrobial Peptide AP01142“>011422676.46 %96.92 %AVP
     
 

APD ID:

AP01142

 
 

Name/Class:

Rabbit kidney defensin RK-2 (alpha-defensins; UCSS1a; animals; 3S=S)

 
 

Source:

Rabbit

 
 

Sequence:

KPYCSCKWRCGIGEEEKGICHKFPIVTYVCCRRP

 
 

Length:

34

 
 

Net charge:

4

 
 

Hydrophobic residue%:

38%

 
 

Boman Index:

1.75 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

To be updated.

 
       
 

Title:

RK-2: a novel rabbit kidney defensin and its implications for renal host defense.

 
 

Author:

Wu ER, Daniel R, Bateman A.1998

 
 

Reference:

Peptides. 1998;19(5):793-9

 
       

Close this window