Antimicrobial Peptide AP01125“>011253191.78 %86.72 %AVP
     
 

APD ID:

AP01125

 
 

Name/Class:

Vibi I (plant cyclotides; plants; XXC; 3S=S, UCBB1b; DXWZ)

 
 

Source:

alpine violet Viola biflora

 
 

Sequence:

GIPCGESCVWIPCLTSTVGCSCKSKVCYRN

 
 

Length:

30

 
 

Net charge:

2

 
 

Hydrophobic residue%:

43%

 
 

Boman Index:

0.62 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

 
 

Crucial residues:

 
 

Additional info:

To be updated.

 
       
 

Title:

The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.

 
 

Author:

Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Göransson U.2008

 
 

Reference:

Phytochemistry. 2008 Feb;69(4):939-52. Pub-Med.

 
       

Close this window