Antimicrobial Peptide AP01081“>010813094.88 %87.70 %AVP
     
 

APD ID:

AP01081

 
 

Name/Class:

Cycloviolacin Y5 (cyclotides; plants; XXC, 3S=S, UCBB1b; ZZHp)

 
 

Source:

Chinese herb Viola yedoensis

 
 

Sequence:

GIPCAESCVWIPCTVTALVGCSCSDKVCYN

 
 

Length:

30

 
 

Net charge:

-1

 
 

Hydrophobic residue%:

53%

 
 

Boman Index:

-0.1 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Antiviral, Anti-HIV, Hemolytic,

 
 

Crucial residues:

 
 

Additional info:

Cycloviolacins Y4 and Y5 are more hydrophobic (>50%) than cycloviolacin Y1 (33%, entry 1077), thereby more hemolytic.

 
       
 

Title:

Anti-HIV cyclotides from the Chinese medicinal herb Viola yedoensis.

 
 

Author:

Wang CK, Colgrave ML, Gustafson KR, Ireland DC, Goransson U, Craik DJ2008

 
 

Reference:

J Nat Prod. 2008 Jan;71(1):47-52. Pub-Med.

 
       

Close this window