Antimicrobial Peptide AP0093“>00932859.77 %91.86 %AVP
     
 

APD ID:

AP00093

 
 

Name/Class:

Rugosin C (frog, amphibians, animals; XXU; 1S=S, UCSS1a)

 
 

Source:

Rana rugosa, Japan, Asia

 
 

Sequence:

GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC

 
 

Length:

37

 
 

Net charge:

4

 
 

Hydrophobic residue%:

45%

 
 

Boman Index:

0.45 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P80956  Go to SwissProt

 
 

Activity:

Anti-Gram+,

 
 

Additional info:

To be updated.

 
       
 

Title:

Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.

 
 

Author:

Suzuki S, Ohe Y, Kagegawa T, Tatemoto K.1995

 
 

Reference:

Biochem. Biophys. Res. Commun. 1995; 212: 249-254. PubMed.

 
       

Close this window