Antimicrobial Peptide AP00929

     
 

APD ID:

AP00929

 
 

Name/Class:

Enterocin AS-48 (AS48, class 2c bacteriocin, Gram-positive bacteria, prokaryotes; XXC; UCBB1a; BBBh2o; Natural variants: enterocin 4, bacteriocin 21, bacteriocin-21, Bac-21; enterococcin EFS2)

 
 

Source:

Enterococcus faecalis S-48

 
 

Sequence:

MAKEFGIPAAVAGTVINVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW

 
 

Length:

70

 
 

Net charge:

6

 
 

Hydrophobic residue%:

51%

 
 

Boman Index:

0 kcal/mol

 
 

3D Structure:

Helix

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1E68   Go to PDB

 
 

Activity:

Anti-Gram+ & Gram-, Antiparasitic,

 
 

Crucial residues:

H1 for cleavage during synthesis, W70 for circularization?, W24 for membrane targeting ()

 
 

Additional info:

First characterized example of an N- and C-end circular bacteriocin. Active against Gram-positive Bacillus, Staphylococcus, and Listeria and Gram-negative Salmonella, E. coli, etc. Also anti-parasitic against T. brucei with an EC50 = 1-3 nM by targeting intracellular compartments (Martínez-García M1, et al. 2018).Monomer at acidic pH but a dimer at physiological pH. The NMR structure consists of five helices in a globular fold. In addition, three crystal structures in complex with different ligands have also been saved into PDB (IDs: 1O82; 1O83; 1O84) (see J Mol Biol 334: 541-549, 2003). You can rotate, zoom, and view the 3D structure here in the PDB . Of note, the circular structure is required for structure and stability, but less essential for activity. The molecule might have already been perfectly designed by nature (Sanchez-Hidalgo M et al 2011 Cell Mol Life Sci 68:2845-57). AS-48 is a good candidate as a natural food preservative. Enterocin 4 has the same sequence as enterocin AS-48, but the former is only active against Gram-positive bacteria (Joosten HM et al 1996 Appl Environ Microbiol 62, 4220-3). The equivalence between Bac21 and AS-48 has been further validated (Kirkpatrick et al., 2018). Updated 7/2011; 10/2011; 9/2012; 5/2013; 4/2018; 7/2018.

 
       
 

Title:

Characterization and partial purification of a broad spectrum antibiotic AS-48 produced by Streptococcus faecalis.

 
 

Author:

Gálvez A, Maqueda M, Valdivia E, Quesada A, Montoya E.1986

 
 

Reference:

Can J Microbiol. 1986 Oct;32(10):765-71. Pub-Med.

 
       

Close this window