Antimicrobial Peptide AP00865“>008652173.16 %100.0 %AVP
     
 

APD ID:

AP00865

 
 

Name/Class:

lactococcin B (LcnB, bacteriocin, Gram-positive bacteria, prokaryotes)

 
 

Source:

Lactococcus lactis subsp. cremoris 9B4

 
 

Sequence:

SLQYVMSAGPYTWYKDTRTGKTLCKQTIDTASYTFGVMAEGWGKTFH

 
 

Length:

13

 
 

Net charge:

1

 
 

Hydrophobic residue%:

61%

 
 

Boman Index:

1.25 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+,

 
 

Crucial residues:

N-terminal six residues. The activity of LcnB depends on the reduced state of the Cys-24 residue.

 
 

Additional info:

APD analysis reveals that the sequence of this peptide shows 34.9% similarity to bacterial Acidocin A. Notably, LcnB can be cleaved by its own proteinase PrtP with an unknown reason. A fragment with the first six amino acid missing was chartacterized and found to be unable to bind to the receptor to inhibit man-PTS sugar uptake. However, the parent peptide was active against L. lactis subsp. lactis BGMN1-501 (Vukotic et al., 2019). Strains carrying the genetic information for the immunity protein against LcnB were not affected by LcnB (Venema et al., 1993). Temporin 1AUa, with no activity at >80 uM against Gram+ bacteria, has been replaced. Updated 5/2019.

 
       
 

Title:

Cloning, sequencing, and expression in Escherichia coli of lcnB, a third bacteriocin determinant from the lactococcal bacteriocin plasmid p9B4-6.

 
 

Author:

van Belkum MJ, Kok J, Venema G. 1992

 
 

Reference:

Appl Environ Microbiol. 1992 Feb;58(2):572-7. PubMed.

 
       

Close this window