Antimicrobial Peptide AP00718

     
 

APD ID:

AP00718

 
 

Name/Class:

gamma1-purothionin (gamma1-P, Greek puro=wheat,defensin, 4S=S, UCSS1a; Plants, DXWZ)

 
 

Source:

wheat endosperm, Triticum turgidum L cv Senatore Capelli

 
 

Sequence:

KICRRRSAGFKGPCMSNKNCAQVCQQEQWQQQNCDQPFRRCKCIRQC

 
 

Length:

47

 
 

Net charge:

8

 
 

Hydrophobic residue%:

36%

 
 

Boman Index:

3.48 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

Method:

NMR

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

 
 

Crucial residues:

 
 

Additional info:

Solution structure was determined by NMR (Bruix M et al., 1993). It has a well-defined triple-stranded antiparallel beta-sheet (residues 1-6, 31-34, and 39-47), an alpha-helix (residues 16-28), and the corresponding connecting loops. Updated 7/2016.

 
       
 

Title:

Gamma-purothionins: amino acid sequence of two polypeptides of a new family of thionins from wheat endosperm

 
 

Author:

Colilla FJ, Rocher A, Mensez E1990

 
 

Reference:

FEBS Lett 1990; 270: 191-194

 
       

Close this window