Antimicrobial Peptide AP00712“>007121874.35 %93.63 %AVP
     
 

APD ID:

AP00712

 
 

Name/Class:

scorpion defensin (UCSS1a; 3S=S, scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals)

 
 

Source:

Leiurus quinquestriatus

 
 

Sequence:

GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN

 
 

Length:

37

 
 

Net charge:

7

 
 

Hydrophobic residue%:

35%

 
 

Boman Index:

2.68 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+,

 
 

Crucial residues:

 
 

Additional info:

According to the APD, this is the first AMP from scorpions.

 
       
 

Title:

Purification and characterization of a scorpion defensin, a 4kDa antibacterial peptide presenting structural similarities with insect defensins and scorpion toxins

 
 

Author:

Cociancich S, et al Hoffmann J1993

 
 

Reference:

Biochem Biophys Res Commun. 1993 Jul 15;194(1):17-22.

 
       

Close this window