Antimicrobial Peptide AP00691“>006912062.98 %98.29 %AVP
     
 

APD ID:

AP00691

 
 

Name/Class:

HFIAP-1 (hagfish cathelicidin, fish, animals; XXH, UCLL1. Also HFIAP-2 )

 
 

Source:

Atlantic hagfish, Myxine glutinosa

 
 

Sequence:

GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR

 
 

Length:

37

 
 

Net charge:

10

 
 

Hydrophobic residue%:

35%

 
 

Boman Index:

3.03 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

W7 and W32 are brominated. Active against Gram+ bacteria P. acnes ATCC 11827 and 33179, S. epidermidi, S. pyogenes, E. faecium, S. aureus ATCC 29213, C. perfringens ATCC 9081 and 13124, E. faecalis (MIC 2-32 uM); Gram- bacteria Bacteroides spp. ATCC 29771, 43935, and 12290, S. sonnei, S. maltophilia, Salmonella Group B, P. aeruginosa ATCC 27853, A. baumannii, E. coli ATCC 25922, E. aerogenes, E. cloacae, K. pneumoniae (MIC 0.5-16). HFIAP-2 is identical to HFIAP-1 in terms of amino acid sequence. However, HFIAP-2 is only brominated at residue W7. Updated 10/2014.

 
       
 

Title:

Hagfish intestinal antimicrobial peptides are ancient cathelicidins

 
 

Author:

Uzzell T, Stolzenberg ED, Shinnar AE, Zasloff M2003

 
 

Reference:

Peptides 2003; 24: 1655-1667

 
       

Close this window