Antimicrobial Peptide AP00675

     
 

APD ID:

AP00675

 
 

Name/Class:

Human beta defensin 4 (hBD-4, hBD4; UCSS1a; primates, mammals, animals; 3S=S)

 
 

Source:

skin, Homo sapiens

 
 

Sequence:

EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

 
 

Length:

50

 
 

Net charge:

6

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

3.42 kcal/mol

 
 

3D Structure:

Bridge

 
 

Method:

X-ray

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+ & Gram-, Chemotactic,

 
 

Crucial residues:

 
 

Additional info:

Like hBD2 and hBD3, the expression of hBD4 can be induced. Active against E. coli ATCC 25922. Activity is salt-sensitive. The S-S bridges are not needed for antibacterial activity. Crystal structure reveals an usual conformation at the N-terminus, explaining why hBD4 does not induce CCR6-mediated chemotaxis (Prahl A et al., 2017). Updated 3/2017; 3/2018.

 
       
 

Title:

Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity

 
 

Author:

García JR, Krause A, Schulz S, Rodríguez-Jiménez FJ, Klüver E, Adermann K, Forssmann U, Frimpong-Boateng A, Bals R, Forssmann WG.2001

 
 

Reference:

FASEB J. 2001 Aug;15(10):1819-21. Pub-Med.

 
       

Close this window