Antimicrobial Peptide AP00626“>006262265.16 %100.0 %AVP
     
 

APD ID:

AP00626

 
 

Name/Class:

human KS-30 (KS30 from parent cathelicidin; UCLL1; primates, mammals, animals)

 
 

Source:

human sweat, Homo sapiens

 
 

Sequence:

KSKEKIGKEFKRIVQRIKDFLRNLVPRTES

 
 

Length:

30

 
 

Net charge:

6

 
 

Hydrophobic residue%:

30%

 
 

Boman Index:

3.47 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

Derived from LL-37. Active against C. albicans. Structure is predicted to be helical based on NMR studies of intact LL-37 and its fragments in micelles.

 
       
 

Title:

Postsecretory processing generates multiple cathelicidins for enahnced topical antimicrobial defense

 
 

Author:

Murakami M et al. Gallo RL2004

 
 

Reference:

J Immunol 2004; 172: 3070-3077. PubMed.

 
       

Close this window