Antimicrobial Peptide AP00624

     
 

APD ID:

AP00624

 
 

Name/Class:

ALL-38 (ALL38; another form of human cathelicidin; UCLL1; primates, mammals, animals)

 
 

Source:

sperm, Homo sapiens

 
 

Sequence:

ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

 
 

Length:

38

 
 

Net charge:

6

 
 

Hydrophobic residue%:

36%

 
 

Boman Index:

2.87 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Crucial residues:

 
 

Additional info:

One gene, two cathelicidin peptides (LL-37 and ALL-38). Compared to LL-37, ALL-38 contains one additional residue (Ala) at the N-terminus. ALL-38 is produced in female vagina under an acidic condition by cleaving the precursor protein hCAP-18 from male semen, presumably providing a sterilized environment for the new life (see the APD entry 00005 for a similar compd in insects). The antimicrobial activities of LL-37 and ALL-38 are similar against bacterial strains (E. coli, P. aeruginosa, S. aureus, and B. megaterium). The APD predicts that the 3D structure and mechanism of action of ALL-38 are very similar, if not identical, to human LL-37 (see APD entry 310).

 
       
 

Title:

Processing of seminal plasma hCAP-18 to ALL-38 by gastricsin

 
 

Author:

Sorensen OE et al Borregaard N2003

 
 

Reference:

J Biol Chem 2003; 278: 28540-28546

 
       

Close this window