Antimicrobial Peptide AP00587

     
 

APD ID:

AP00587

 
 

Name/Class:

Brevinin-2TSa (frog, amphibians, animals; XXU; 1S=S, UCSS1a)

 
 

Source:

Rana tsushimensis, Asia

 
 

Sequence:

GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC

 
 

Length:

33

 
 

Net charge:

4

 
 

Hydrophobic residue%:

45%

 
 

Boman Index:

0 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal, candidacidal, Anti-MRSA,

 
 

Crucial residues:

 
 

Additional info:

Broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria, including E. coli ATCC25922, E. cloacae HNTCC 5300, P. aeruginosa ATCC 27853, K. pneumoniae KK3 9904 (MIC 6 uM), S. aureus NCTC 8325, S. epidermidis RP62A (MIC 12.5 uM), E. faecalis ATCC 29212, MRSA T7/20 (MIC 25 uM), C. albicans ATCC 90028 (MIC 100 uM), HC50 100 uM. Updated 5/2020.

 
       
 

Title:

Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis

 
 

Author:

Conlon JM, et al., Iwamuro S.2006

 
 

Reference:

Comp. Biochem. Physiol. part C, 2006; 143: 42-49. PubMed.

 
       

Close this window