Antimicrobial Peptide AP00549

     
 

APD ID:

AP00549

 
 

Name/Class:

Plectasin (fungi, fungal defensin; UCSS1a; 3S=S, fungii; BBW; Derivatives: NZ2114)

 
 

Source:

Pseudoplectania nigrella

 
 

Sequence:

GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

 
 

Length:

40

 
 

Net charge:

1

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

1.4 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1ZFU   Go to PDB

 
 

Activity:

Anti-Gram+, Antiviral, Antifungal, Anti-MRSA,

 
 

Crucial residues:

 
 

Additional info:

It is the first fungal defensin identified in the secretome of the ascomycete P. nigrella. Multiple microbial strains were tested. Active against Gram+ bacteria S. pneumoniae PSSP, S. pyogenes ESSP, S. aureus MSSA or MRSA (MIC 4-32, or >128 mg/l), S. epidermidis MSSE or MRSE (MIC 4-32 uM), E. faecium (MIC 16-64, or >128), C. diphtheriae (MIC 2-8), C. jeikeium (MIC 1-2), B. thuringiensis (MIC 32-64). Plectasin showed no cytotoxicity to A549 cells, normal human bronchial epithelial cells, or lung fibroblasts, and it did not induce IL-8 transcription or production in A549 cells. The results suggest that plectasin could be an inoffensive alternative antibiotic for clinical application (BBRC 2008 Oct 3;374(4):709-13). Recently, high-resolution crystal structure (PDB entries: 3E7U for the L-form and 3E7R for the racemic form) has also been determined (Madel K et al. 2009) Protein Sci. 18: 1146-54) using racemic crystallography, and the peptide adopts the same fold as that found in solution by NMR. You can rotate, zoom, and view the 3D structure here in the PDB. Of note, L-plectasin showed the anticipated antimicrobial activity. However, the D-form is INACTIVE (D<

 
       
 

Title:

Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus

 
 

Author:

Mygind PH, Fischer RL, Schnorr KM, Hansen MT, S÷nksen CP, Ludvigsen S, Raventˇs D, Buskov S, Christensen B, De Maria L, Taboureau O, Yaver D, Elvig-J°rgensen SG, S°rensen MV, Christensen BE, Kjaerulff S, Frimodt-Moller N, Lehrer RI, Zasloff M, Kristensen HH.2005

 
 

Reference:

Nature. 2005 Oct 13;437(7061):975-80. PubMed.

 
       

Close this window