Antimicrobial Peptide AP00529

     
 

APD ID:

AP00529

 
 

Name/Class:

Ericin S (lantibiotic, type 1, class 1 bacteriocin, Gram-positive bacteria, prokaryotes; XXT5; UCSS1b; XXW2)

 
 

Source:

Bacillus subtilis A1/3

 
 

Sequence:

WKSESVCTPGCVTGVLQTCFLQTITCNCHISK

 
 

Length:

32

 
 

Net charge:

1

 
 

Hydrophobic residue%:

43%

 
 

Boman Index:

0.56 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

anti-Gram+,

 
 

Additional info:

2 Di-dehydroalanines (Dha), S3, S31; 1 Di-dehydrobutyrine (Dhb), T18; 1 Lanthionine, S3-C7; 4 Methyllanthionines, T8-C11, T13-C19, T23-C26, T25-C28

 
       
 

Title:

Two different lantibiotic-like peptides originate from the ericin gene cluster of Bacillus subtilis A1/3.

 
 

Author:

Stein T, Borchert S, Conrad B, Feesche J, Hofemeister B, Hofemeister J, Entian KD.2002

 
 

Reference:

J. Bacteriol. 2002; 184:1703-1711. PubMed.

 
       

Close this window