Antimicrobial Peptide AP00488“>004882073.97 %98.00 %AVP
     
 

APD ID:

AP00488

 
 

Name/Class:

Cupiennin 1d (spiders, arachnids, Chelicerata, arthropods, invertebrates, animals; ZZI; UCLL1a)

 
 

Source:

Cupiennius salei

 
 

Sequence:

GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME

 
 

Length:

35

 
 

Net charge:

7

 
 

Hydrophobic residue%:

45%

 
 

Boman Index:

0.88 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

Reference ID: Ref  

 
 

Activity:

Anti-Gram+ & Gram-, Insecticidal,

 
 

Additional info:

To be updated.

 
       
 

Title:

Cupiennin 1, a New Family of Highly Basic Antimicrobial Peptides in the Venom of the Spider Cupiennius salei (Ctenidae)

 
 

Author:

Kuhn-Nentwig L, Muller J, Schaller J, Walz A, Dathe M, Nentwig W2002

 
 

Reference:

J Biol Chem. 2002 Mar 29;277(13):11208-16. PubMed.

 
       

Close this window