Antimicrobial Peptide AP00429

     
 

APD ID:

AP00429

 
 

Name/Class:

Porcine NK-Lysin (saposin-like protein, SAPLIP, pigs, mammals; animals; BBMm, BBL, ZZP; 3S=S; UCSS1a; Derivatives: NK-2; NK-18)

 
 

Source:

cytotoxic T and NK cells, small intestine, domestic pig Sus scrofa

 
 

Sequence:

GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE

 
 

Length:

78

 
 

Net charge:

6

 
 

Hydrophobic residue%:

42%

 
 

Boman Index:

1.92 kcal/mol

 
 

3D Structure:

Helix

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1NKL   Go to PDB

 
 

Activity:

anti-Gram+ & Gram-, antifungal, antiparasitic, Antimalarial, Cancer cells

 
 

Additional info:

Highly active against E. coli and B. megaterium and moderately active against A. calcoaceticus and S. pyogenes. The peptide showed a marked lytic activity against an NK-sensitive mouse tumour cell line, YAC-1, but it did not lyse red blood cells. This porcine AMP contains 3 disulfide bonds and 5 helices (NMR by Liepinsh E et al. Nat Struct Biol 1997; 4: 793). You can rotate, zoom, and view the 3D structure here in the PDB. NK-2, the antimicrobial core region corresponding to residues K39-K65, was found to possesses antibacterial and antifungal activities (C. albicans) but poor toxicity to human cells (Antimicrob Agents Chemother 47: 607-13, 2003). NK-2 kills intraerythrocytic P. falciparum (Antimicrob. Agents Chermother. 52: 1713-1720 (2008). NK-2 also binds to LPS. NK-18 (KILRGVCKKIMRTFLRRI-amide, 18 aa, residues 39-57) possesses potent antitumor activity against bladder and prostate cancer cells by disrupting the integrity of cell membrane (helical in 50% TFE, CD) (Yan et al., 2012). Sequence and major ref updated 7/2013; Jan2014; seq updated 2/2018.

 
       
 

Title:

NK-lysin, a novel effector peptide of cytotoxic T and NK cells. Structure and cDNA cloning of the porcine form, induction by interleukin 2, antibacterial and antitumour activity.

 
 

Author:

Andersson M, Gunne H, Agerberth B, Boman A, Bergman T, Sillard R, Jörnvall H, Mutt V, Olsson B, Wigzell H, et al. 1995

 
 

Reference:

EMBO J. 1995 Apr 18;14(8):1615-25. PubMed.

 
       

Close this window