Antimicrobial Peptide AP00418

     
 

APD ID:

AP00418

 
 

Name/Class:

CAP18(106-142) (rabbit cathelicidin, BBL, animals)

 
 

Source:

granulocytes, Rabbit, Oryctolagus cuniculus

 
 

Sequence:

GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY

 
 

Length:

37

 
 

Net charge:

12

 
 

Hydrophobic residue%:

29%

 
 

Boman Index:

3.01 kcal/mol

 
 

3D Structure:

Helix

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1LYP   Go to PDB

 
 

Activity:

Anti-Gram+ & Gram-, Anti-MRSA,

 
 

Additional info:

This appears to be the first peptide in the cathelicidin family demonstrated to have antibacterial activity against various Gram-positive (S. pneumoniae, S. pyogenes, and S. aureus) and Gram-negative bacteria (E. coli HB101, K. pneumoniae, P. aeruginosa, and P. apacia). Activity remains in serum. 3D structure of a 32-residue N-terminal fragment (PDB entry 1LYP) was determined in 30% TFE by solution NMR as a complete and rigid helix (Chen C et al. 1995 FEBS Lett 370: 46-52). You can rotate, zoom, and view the 3D structure in 30% TFEhere in the PDB. A 13-residue fragment with a sequence KIKEKLKKIGQKI was found to be active against P. aeruginosa PAO1 at a MIC 14.8 uM (cf. full length CAP18, MIC was 0.22 uM) (Travis SM et al. 2000 Infect Immunity 68: 2748-55). Updated 12/2011; 6/2019.

 
       
 

Title:

Antimicrobial activity of rabbit CAP18-derived peptides

 
 

Author:

Larrick JW, Hirata M, Shimomoura Y, Yoshida M, Zheng H, Zhong J, Wright SC.1993

 
 

Reference:

Antimicrob Agents Chemother. 1993 Dec;37(12):2534-9.

 
       

Close this window