Antimicrobial Peptide AP00377“>003772583.19 %98.01 %AVP
     
 

APD ID:

AP00377

 
 

Name/Class:

Ponericin G2 (antss, insects, arthropods, invertebrates, animals)

 
 

Source:

Pachycondyla goeldii

 
 

Sequence:

GWKDWLKKGKEWLKAKGPGIVKAALQAATQ

 
 

Length:

30

 
 

Net charge:

5

 
 

Hydrophobic residue%:

43%

 
 

Boman Index:

0.81 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P82415  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal,

 
 

Additional info:

The comparison of ponericins with those well-studied peptides suggests that ponericins may adopt an amphipathic alpha-helical structure on cell membranes.

 
       
 

Title:

Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.

 
 

Author:

Orivel J, Redeker V, Le Caer JP, Krier F, Revol-Junelles AM, Longeon A, Chaffotte A, Dejean A, Rossier J.2001

 
 

Reference:

J. Biol. Chem. 2001; 276: 17823-17829. PubMed.

 
       

Close this window