Antimicrobial Peptide AP00372“>003721953.39 %95.65 %AVP
     
 

APD ID:

AP00372

 
 

Name/Class:

Virescein (insects, arthropods, invertebrates, animals)

 
 

Source:

Noctuid moth Heliothis virescens

 
 

Sequence:

GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH

 
 

Length:

41

 
 

Net charge:

9

 
 

Hydrophobic residue%:

39%

 
 

Boman Index:

1.18 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P83416  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-,

 
 

Additional info:

To be updated.

 
       
 

Title:

 
 

Author:

Bulet P, Lamberty M., Brookhart G., Bushey D.2002

 
 

Reference:

Submitted JUL-2002 to the SWISS-PROT data bank

 
       

Close this window