Antimicrobial Peptide AP00285

     
 

APD ID:

AP00285

 
 

Name/Class:

Cryptdin-4 (Crp4, Crp-4; defensins; UCSS1a; mouse, mammals, animals; 3S=S)

 
 

Source:

Mus musculus

 
 

Sequence:

GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR

 
 

Length:

32

 
 

Net charge:

8

 
 

Hydrophobic residue%:

37%

 
 

Boman Index:

2.83 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 2GW9   Go to PDB

 
 

Activity:

Anti-Gram+ & Gram-, Anti-MRSA,

 
 

Crucial residues:

A few residues at the N-terminus are critical for antibacterial activities.

 
 

Additional info:

Active against S. aureus (MRSA). It contains three disulfide bonds.You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014.

 
       
 

Title:

Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.

 
 

Author:

Ouellette,A.J., Hsieh,M.M., Nosek,M.T., Cano-Gauci,D.F., Huttner,K.M., Buick,R.N., Selsted,M.E.1994

 
 

Reference:

Infect. Immun. 1994; 62: 5040-5047

 
       

Close this window