Antimicrobial Peptide AP00283

     
 

APD ID:

AP00283

 
 

Name/Class:

Human beta defensin 3 (hBD-3, hBD3, or DEFB103, human defensin, 3S=S, UCSS1a; primates, mammals, animals; ZZHh; BBBh2o; BBW; JJsn)

 
 

Source:

skin, tonsils, oral/saliva, Homo sapiens

 
 

Sequence:

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

 
 

Length:

45

 
 

Net charge:

11

 
 

Hydrophobic residue%:

33%

 
 

Boman Index:

2.87 kcal/mol

 
 

3D Structure:

Combine Helix and Beta structure

 
 

Method:

NMR

 
 

SwissProt ID:

PDB ID: 1KJ6   Go to PDB

 
 

Activity:

anti-Gram+ & Gram-, antiviral, antifungal, anti-HIV, Chemotactic, Anti-MRSA, Antibiofilm, wound healing, Cancer cells

 
 

Crucial residues:

C-terminal double RR

 
 

Additional info:

An inducible human AMP. Active against multiple species, including MRSA. It showed synergistic effect with LL-37 in killing S. aureus (Abou Aliwa et al., 2014). In addition to antibacterial effects, hBD-2 and hBD-3 induce chemotaxis via interactions with CCR2 or CCR6 expressing cells (Rohr J et al. 2010 J Immunol 184:6688-94). It contains three disulfide bonds and a short helical segment preceding a three-stranded antiparallel beta-sheet. These bridges are needed for chemotactic but not antibacterial activity. It is a dimer in solution, which may be responsible for high antibacterial activity. Cf. HBD1 and HBD2 are monomers in solution (Schibli DJ et al. 2002 J Biol Chem 277: 8279). You can rotate, zoom, and view the 3D structure here in the PDB. MOA: This peptide inhibits cell wall biosynthesis in Staphylococci (Sass V et al 2010 Infect Immu 78: 2793-800). Delete the double arginines RR at the C-terminus of hBD-3 or shifting them to the N-terminus reduced peptide activity against S. aureus by 5 fold (Sakagami-Yasui Y et al., 2017). Its anti-HIV-1 effect may be due to a direct interaction with virions and through modulation of the CXCR4 co-ceceptor (Weinberg et al 2006 Adv Dent Res 19: 42-8). It also has the wound healing effect (Hirsch T et al., 2009). Updated Jan2011; 12/2013.2/2015; 6/2017; 9/2017.

 
       
 

Title:

Isolation and characterization of human deta-defensin-3, a novel human inducible peptide antibiotic.

 
 

Author:

Harder J, Bartels J, Christophers E, Schroeder JM.2001

 
 

Reference:

J. Biol. Chem. 2001; 276:5707-5713

 
       

Close this window