Antimicrobial Peptide AP00281

     
 

APD ID:

AP00281

 
 

Name/Class:

mCRAMP (mouse cathelin-related antimicrobial peptide; cathelicidin, mammals, animals; derivatives: CRAMP 18)

 
 

Source:

adult testis, spleen, stomach, and intestine, Mouse, Mus musculus

 
 

Sequence:

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

 
 

Length:

34

 
 

Net charge:

6

 
 

Hydrophobic residue%:

29%

 
 

Boman Index:

1.74 kcal/mol

 
 

3D Structure:

Helix

 
 

Method:

NMR

 
 

SwissProt ID:

SwissProt ID: P51473  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-, Antiviral, Antifungal, Anti-MRSA, Anticancer

 
 

Additional info:

Active against E. coli ATCC 25922, E. coli ML35, E. coli D21 (MIC 0.5-2 uM), S. typhimurium ATCC 14028, P. aeruginosa ATCC 27853, S. marcescens ATCC 8100 (MIC 4-8), S. aureus ATCC 25923, S. aureus Cowan I, MRSA (MIC 32-64), S. epidermidis ATCC 12228, S. faecalis ATCC 29212 (MIC 16 uM), B. megaterium Bm11 (MIC 4 uM), fumgi C. neoformans (MIC 16 uM), and the single-stranded RNA virus respiratory syncytial virus (RSV). IL-17A and IL-17F are essential for the production of CRAMP to clear S. aureus nasal colonization (Archer NK et al., 2016). CRAMP 18 is a fragment of CRAMP from G16 to L33 and retains antibacterial activity Shin SY et al., 2000. CRAMP18 is active against E. coli, S. typhimurium, P. aeruginosa, B. subtilis, S. pyogenes, S. aureus (MIC 3.1-6.2 uM), C. albicans (MIC 50 uM), A. fumigatus (100 uM) (cf. CRAMP antifungal MIC 12.5 uM). CRAMP is also anticancer (tumor cells A549, K562, Jurkat, IC50 16-28 uM) with 2.2% hemolysis at 100 uM. Chnage residue 2, 9, or 13 to K made CRAMP-18 anticancer as well but not better than its parent molecule. Updated 11/2015; 4/2016; 10/2016.

 
       
 

Title:

Identification of CRAMP, a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse.

 
 

Author:

Gallo RL, Kim KJ, Bernfield M, Kozak CA, Zanetti M, Merluzzi L, Gennaro R.1997

 
 

Reference:

J. Biol. Chem. 1997: 272:13088-13093. PubMed

 
       

Close this window