Antimicrobial Peptide AP00237“>002372485.67 %100.0 %AVP
     
 

APD ID:

AP00237

 
 

Name/Class:

Phoratoxin (UCSS1a; 3S=S; plants)

 
 

Source:

California mistletoe Phoradendron tomentosum subsp. macrophyllum (Loranthaceae)

 
 

Sequence:

KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH

 
 

Length:

46

 
 

Net charge:

6

 
 

Hydrophobic residue%:

32%

 
 

Boman Index:

1.83 kcal/mol

 
 

3D Structure:

Bridge

 
 

SwissProt ID:

SwissProt ID: P01539  Go to SwissProt

 
 

Activity:

Hemolytic,

 
 

Additional info:

Three disulfide bridges: 3,40; 4,32; 16,26;

 
       
 

Title:

Phoratoxin, a toxic protein from the mistletoe Phoradendron tomentosum subsp. macrophyllum (Loranthaceae). The disulphide bonds.

 
 

Author:

Mellstrand ST, Samuelsson G.1974

 
 

Reference:

Acta Pharm. Suec. 1974; 11:367-374

 
       

Close this window