Antimicrobial Peptide AP00235“>002352476.96 %95.12 %AVP
     
 

APD ID:

AP00235

 
 

Name/Class:

Bovine tracheal antimicrobial peptide (TAP, beta defensin; UCSS1a; cattle, ruminant, mammals, animals; 3S=S)

 
 

Source:

mucosal epithelial cells, Bos taurus

 
 

Sequence:

NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK

 
 

Length:

38

 
 

Net charge:

9

 
 

Hydrophobic residue%:

42%

 
 

Boman Index:

1.71 kcal/mol

 
 

3D Structure:

Beta

 
 

Method:

NMR

 
 

SwissProt ID:

SwissProt ID: P25068  Go to SwissProt

 
 

Activity:

Anti-Gram+ & Gram-, Antifungal,

 
 

Additional info:

First beta-defensins discovered. Three disulfide bridges: 5,34; 12,27; 17,35;

 
       
 

Title:

Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA.

 
 

Author:

Diamond G, Zasloff M, Eck H, Brasseur M, Maloy WL, Bevins CL.1991

 
 

Reference:

Proc Natl Acad Sci U S A. 1991 May 1;88(9):3952-6

 
       

Close this window