Antimicrobial Peptide AP0023“>00232583.36 %98.84 %AVP
     
 

APD ID:

AP00023

 
 

Name/Class:

Antiviral protein Y3 (edible fungi, fungii; UCSS1a)

 
 

Source:

Golden oyster mushroom, Pleurotus citrinopileatus

 
 

Sequence:

AACARFIDDFCDTLTPNIYRPRDNGQRCYAVNGHRCDFTVFNTNNGGNPIRASTPNCKTVLRTAANRCPTGGRGKINPNAPFLFAIDPNDGDCSTNF

 
 

Length:

97

 
 

Net charge:

4

 
 

Hydrophobic residue%:

35%

 
 

Boman Index:

2.44 kcal/mol

 
 

3D Structure:

Unknown

 
 

SwissProt ID:

SwissProt ID: P83477  Go to SwissProt

 
 

Activity:

Antiviral, Anticancer

 
 

Additional info:

Antiviral protein Y3: at 2.0?g/ml achieved 50.0% inhibition of tobacco mosaic virus (TMV, 20?g/ml) lesions in Nicotiana glutinosa leaves. (provided by Chunfeng Wang). Submitted OCT-2002 to the SWISS-PROT data bank. It shows antiviral activity against Tobacco mosaic virus and antitumor activity against stomach cancer cells in vitro. Full sequence updated 03/12 GW.

 
       
 

Title:

Characterization and amino acid sequence of y3, an antiviral protein from mushroom Coprinus comatus

 
 

Author:

Wu,L.-P., Wu,Z.-J., Lin,D, Fang F, Lin Q.-Y., Xie,L.-H.2002

 
 

Reference:

Chinese J Biochem Mol Biol 2008; 24(7):597-603. OnlineJournal.

 
       

Close this window